Recombinant Mouse RAGE Protein

Cat. No.: rp214432
Disponibile su ordine
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) expressed in HEK293, See COA
Accession #
Q62151
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
★
Size
Germania (EU)
USA*
Price
Qty
10μg
rp214432-10μg
Su ordinazione · 8–12 settimane
69,33€
50μg
rp214432-50μg
Su ordinazione · 8–12 settimane
216,85€
100μg
rp214432-100μg
Su ordinazione · 8–12 settimane
347,01€
1mg
rp214432-1mg
Su ordinazione · 8–12 settimane
2.256,03€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,His-Tag,≥95%(SDS-PAGE),expressed in HEK293, See COA Animal Free,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Mouse RAGE Protein
Sinonimi
advancedglycosylationendproduct-specificreceptor | AGER | RAGEisoformdelta | RAGEisoformsRAGE-delta | RAGE | Receptorforadvancedglycosylationendproducts | receptorforadvancedglycosylationend-products | SCARJ1 | Ager | Rage
Grado
Animal Free, Carrier Free, His Tag
Specifiche e purezza
Animal Free,Carrier Free,His-Tag,≥95%(SDS-PAGE),expressed in HEK293, See COA
Meccanismi biochimici e fisiologici
Advanced glycation endproducts (AGE) are adducts formed by the non-enzymatic glycation or oxidation of macromolecules. AGE forms during aging and its formation is accelerated under pathophysiologic states such as diabetes, Alzheimer’s disease, renal failu
Bioattività
Testing in progress
Concentrazione di endotossina
<1.0 EU/μg
Aminoacidi
1-342 aa
Sequenza
MPAGTAARAWVLVLALWGAVAGGQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALAHHHHHH
Numero d'ordine
Peso molecolare previsto
34.8 kDa
SDS-PAGE
43.3 kDa, under reducing conditions; 41.1 kDa, under non-reducing conditions.
Tipo di molecola
Proteine
Stoccaggio e spedizione
Concentrazione
expressed in HEK293, See COA
Ricostituzione
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condizioni di conservazione di stoccaggio
Store at -20°C,Avoid repeated freezing and thawing
Spedito in
Ice chest + Ice pads
Stabilità e conservazione
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Immagini
Recombinant Mouse RAGE Protein (rp214432) - SDS-PAGE
 3 μg/lane of Recombinant Mouse RAGE Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 43.3 kDa under reducing conditions and 41.1 kDa under non-reducing conditions.
Applicazione
ApplicazioneDilution info

Documentazione

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataOggetto
ZJ26F0333113Certificate of AnalysisMar 18, 2026 rp214432
ZJ26F0333114Certificate of AnalysisMar 18, 2026 rp214432
ZJ26F0333115Certificate of AnalysisMar 18, 2026 rp214432
Calcolatori di soluzioni
Recensioni

Recensioni dei clienti

Domande frequenti

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Animal Free grade guide → View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.