DUT

DescrizioneDeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial

Gene and Protein Information

Gene ID1854
Uniprot Accession IDs P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 dUTPase
Ensembl ID ENSP00000370376
Symbol dUTPase
FamilyBelongs to the dUTPase family.
Sequence
MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Horse100070214DUTdeoxyuridine triphosphatase9796VGNC:17360OMA, EggNOG
S.cerevisiae852554DUT1bifunctional dITP/dUTP diphosphatase4932S000000456OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.