RAMP2

DescrizioneReceptor activity-modifying protein 2

Gene and Protein Information

Gene ID10266
Uniprot Accession IDs O60895 A7L9S6 K7EMD3 Q8N1F2
Ensembl ID ENSP00000253796
FamilyBelongs to the RAMP family.
Sequence
MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp454698RAMP2receptor activity modifying protein 29598VGNC:9553OMA, EggNOG
Macaque707718RAMP2receptor activity modifying protein 29544Inparanoid, OMA, EggNOG
Mouse54409Ramp2receptor (calcitonin) activity modifying protein 210090MGI:1859650Inparanoid, OMA, EggNOG
Rat58966Ramp2receptor activity modifying protein 210116RGD:61872Inparanoid, OMA, EggNOG
Dog480515RAMP2receptor activity modifying protein 29615Inparanoid, OMA, EggNOG
HorseRAMP2receptor activity modifying protein 2 [Source:HGNC Symbol;Acc:HGNC:9844]9796OMA, EggNOG
Cow504230RAMP2receptor activity modifying protein 29913VGNC:33707Inparanoid, OMA, EggNOG
Pig397155RAMP2receptor activity modifying protein 29823Inparanoid, OMA, EggNOG
Opossum100011362RAMP2receptor activity modifying protein 213616Inparanoid, OMA, EggNOG
Chicken420022RAMP2receptor activity modifying protein 29031CGNC:17380Inparanoid, EggNOG
Anole lizardRAMP2receptor activity modifying protein 2 [Source:HGNC Symbol;Acc:HGNC:9844]28377Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.