🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

RAB24

DescrizioneRas-related protein Rab-24

Gene and Protein Information

Gene ID53917
Uniprot Accession IDs Q969Q5 A0A024R7N9 Q7Z4Z7
Ensembl ID ENSP00000304376
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp471755RAB24RAB24, member RAS oncogene family9598VGNC:8633OMA, EggNOG
Macaque698876RAB24RAB24, member RAS oncogene family9544OMA, EggNOG
Mouse19336Rab24RAB24, member RAS oncogene family10090MGI:105065Inparanoid, OMA, EggNOG
Dog479277RAB24RAB24, member RAS oncogene family9615VGNC:45264Inparanoid, OMA, EggNOG
Horse100058530RAB24RAB24, member RAS oncogene family9796VGNC:22097Inparanoid, OMA, EggNOG
Cow617635RAB24RAB24, member RAS oncogene family9913VGNC:33631Inparanoid, OMA, EggNOG
Pig100511865RAB24RAB24, member RAS oncogene family9823Inparanoid, OMA, EggNOG
Opossum100027665RAB24RAB24, member RAS oncogene family13616Inparanoid, EggNOG
Chicken427627RAB24RAB24, member RAS oncogene family9031CGNC:2157Inparanoid, OMA, EggNOG
Anole lizard100563654rab24RAB24, member RAS oncogene family28377Inparanoid, OMA, EggNOG
Xenopus548925rab24RAB24, member RAS oncogene family8364XB-GENE-491489Inparanoid, OMA, EggNOG
Zebrafish574423rab24RAB24, member RAS oncogene family7955ZDB-GENE-050706-110Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.