🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

RAB21

DescrizioneRas-related protein Rab-21

Gene and Protein Information

Gene ID23011
Uniprot Accession IDs Q9UL25 Q14466 Q569H3
Ensembl ID ENSP00000261263
Symbol KIAA0118
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp467069RAB21RAB21, member RAS oncogene family9598VGNC:13352OMA, EggNOG
Mouse216344Rab21RAB21, member RAS oncogene family10090MGI:894308Inparanoid, OMA, EggNOG
Rat299799Rab21RAB21, member RAS oncogene family10116RGD:1303150Inparanoid, OMA, EggNOG
Dog100683312RAB21RAB21, member RAS oncogene family9615VGNC:45261Inparanoid, OMA, EggNOG
Horse100056811RAB21RAB21, member RAS oncogene family9796VGNC:22094Inparanoid, OMA, EggNOG
Cow781001RAB21RAB21, member RAS oncogene family9913VGNC:33628Inparanoid, OMA, EggNOG
Platypus100087487RAB21RAB21, member RAS oncogene family9258OMA, EggNOG
Chicken771383RAB21RAB21, member RAS oncogene family9031CGNC:7744Inparanoid, OMA, EggNOG
Anole lizard100551608rab21RAB21, member RAS oncogene family28377Inparanoid, OMA, EggNOG
Xenopus549073rab21RAB21, member RAS oncogene family8364XB-GENE-486436Inparanoid, OMA, EggNOG
Zebrafish767727zgc:154045zgc:1540457955ZDB-GENE-060929-1062Inparanoid, OMA
C. elegans187932rab-21RAB family6239Inparanoid, OMA
Fruitfly3355163Rab21CG17515 gene product from transcript CG17515-RD7227FBgn0039966Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.