Toggle Nav 
Cerca
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | Ras-related C3 botulinum toxin substrate 1 |
|---|
Gene and Protein Information
| Gene ID | 5879 |
|---|---|
| Uniprot Accession IDs | P63000 O95501 P15154 Q3Y4D3 Q5JAA8 Q9BTB4 |
| Ensembl ID | ENSP00000348461 |
| Symbol | TC25 MIG5 MRD48 Rac-1 TC-25 p21-Rac1 |
| Family | Belongs to the small GTPase superfamily. Rho family. |
| Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 741907 | RAC1 | ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) | 9598 | OMA, EggNOG | |
| Mouse | 19353 | Rac1 | Rac family small GTPase 1 | 10090 | MGI:97845 | Inparanoid, OMA |
| Rat | 363875 | Rac1 | Rac family small GTPase 1 | 10116 | RGD:619755 | Inparanoid, OMA |
| Dog | 403955 | RAC1 | Rac family small GTPase 1 | 9615 | VGNC:49609 | Inparanoid, OMA |
| Cow | 281440 | RAC1 | Rac family small GTPase 1 | 9913 | Inparanoid, OMA | |
| Opossum | 100026992 | RAC1 | Rac family small GTPase 1 | 13616 | Inparanoid, OMA | |
| Platypus | 100076220 | RAC1 | Rac family small GTPase 1 | 9258 | Inparanoid, OMA | |
| Anole lizard | 100561917 | rac1 | Rac family small GTPase 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 448118 | rac1 | Rac family small GTPase 1 | 8364 | XB-GENE-489008 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / enzyme modulator / small GTPase / Ras-related C3 botulinum toxin substrate 1
protein / enzyme modulator / small GTPase / Ras-related C3 botulinum toxin substrate 1
DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related C3 botulinum toxin substrate 1
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related C3 botulinum toxin substrate 1
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifiche | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Ricordamelo più tardi
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.