🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PELI1

DescrizioneE3 ubiquitin-protein ligase pellino homolog 1

Gene and Protein Information

Gene ID57162
Uniprot Accession IDs Q96FA3 Q96SM0 Q9GZY5 Q9HCX0 Pellino-1
Ensembl ID ENSP00000351789
Symbol PRISM
FamilyBelongs to the pellino family.
Sequence
MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp746407PELI1pellino E3 ubiquitin protein ligase 19598VGNC:333OMA, EggNOG
Mouse67245Peli1pellino 110090MGI:1914495Inparanoid, OMA, EggNOG
Rat305549Peli1pellino E3 ubiquitin protein ligase 110116RGD:1311199Inparanoid, OMA
Dog481388PELI1pellino E3 ubiquitin protein ligase 19615VGNC:44414Inparanoid, OMA
Horse100051401PELI1pellino E3 ubiquitin protein ligase 19796VGNC:21305Inparanoid, OMA
Cow535054PELI1pellino E3 ubiquitin protein ligase 19913VGNC:32740Inparanoid, OMA
Platypus100078304PELI1pellino E3 ubiquitin protein ligase 19258Inparanoid, OMA
Chicken421279PELI1pellino E3 ubiquitin protein ligase 19031CGNC:51458Inparanoid, OMA
Anole lizard100553038peli1pellino E3 ubiquitin protein ligase 128377Inparanoid, OMA
Xenopus100125008peli2pellino E3 ubiquitin protein ligase family member 28364XB-GENE-992979Inparanoid, OMA
Zebrafish558420peli1bpellino E3 ubiquitin protein ligase 1b7955ZDB-GENE-061027-372Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.