🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

RAC2

DescrizioneRas-related C3 botulinum toxin substrate 2

Gene and Protein Information

Gene ID5880
Uniprot Accession IDs P15153 Q9UDJ4
Ensembl ID ENSP00000249071
Symbol Gx EN-7 HSPC022 p21-Rac2
FamilyBelongs to the small GTPase superfamily. Rho family.
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Mouse19354Rac2Rac family small GTPase 210090MGI:97846Inparanoid, OMA
Rat366957Rac2Rac family small GTPase 210116RGD:1307568Inparanoid, OMA
Dog481271RAC2Rac family small GTPase 29615VGNC:49610Inparanoid, OMA
Horse100054701RAC2Rac family small GTPase 29796VGNC:49130Inparanoid, OMA
Cow327671RAC2Rac family small GTPase 29913VGNC:49061Inparanoid, OMA
OpossumRAC2Rac family small GTPase 2 [Source:HGNC Symbol;Acc:HGNC:9802]13616Inparanoid, OMA
Platypus100092844RAC2Rac family small GTPase 29258Inparanoid, OMA
Chicken418044RAC2ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)9031CGNC:9462Inparanoid, OMA
Anole lizard100557692rac2Rac family small GTPase 228377Inparanoid, OMA
Zebrafish415151rac2Rac family small GTPase 27955ZDB-GENE-040625-27Inparanoid, OMA
C. elegans186939rac-2Ras-related protein rac-26239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    small GTPase    /    Ras-related C3 botulinum toxin substrate 2
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Small GTPase    /    Ras-related C3 botulinum toxin substrate 2

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.