I JavaScript sembrano essere disabilitati nel tuo browser. Per una migliore esperienza sul nostro sito, assicurati di attivare i javascript nel tuo browser.

Toggle Nav

Carrello

Cerca

Ordine rapido SDS / CoA Structure Massivo e personalizzato

Confronta i prodotti

Account

Impostazioni

Lingua

྾

224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

Home
Targets(Human)
RBBP7

RBBP7

Descrizione	Histone-binding protein RBBP7

Gene and Protein Information

Gene ID	5931
Uniprot Accession IDs	Q16576 Q5JP00
Ensembl ID	ENSP00000369424
Symbol	RBAP46 RbAp46
Family	Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.
Sequence	MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS Mostra altro

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Nome	Codice fiscale	Other Gene ID	Sorgenti
Chimp	465518	RBBP7	RB binding protein 7, chromatin remodeling factor	9598	VGNC:1203	Inparanoid, OMA, EggNOG
Macaque	713843	RBBP7	RB binding protein 7, chromatin remodeling factor	9544		Inparanoid, OMA
Mouse	245688	Rbbp7	retinoblastoma binding protein 7, chromatin remodeling factor	10090	MGI:1194910	Inparanoid, OMA
Rat	83712	Rbbp7	RB binding protein 7, chromatin remodeling factor	10116	RGD:620125	Inparanoid, OMA
Dog	480854	RBBP7	RB binding protein 7, chromatin remodeling factor	9615	VGNC:45393	Inparanoid, OMA
Horse	100056761	RBBP7	RB binding protein 7, chromatin remodeling factor	9796	VGNC:22221	Inparanoid, OMA
Cow	537402	RBBP7	RB binding protein 7, chromatin remodeling factor	9913	VGNC:33772	Inparanoid, OMA
Opossum	100016649	RBBP7	RB binding protein 7, chromatin remodeling factor	13616		Inparanoid, OMA
Platypus	100085544	RBBP7	RB binding protein 7, chromatin remodeling factor	9258		Inparanoid, OMA
Chicken	395390	RBBP7	RB binding protein 7, chromatin remodeling factor	9031	CGNC:12390	Inparanoid, OMA
Xenopus	394900	rbbp7	retinoblastoma binding protein 7	8364	XB-GENE-487909	Inparanoid, OMA, EggNOG
C. elegans	172802	lin-53	Probable histone-binding protein lin-53	6239		Inparanoid, OMA
S.cerevisiae	856654	HAT2	Hat2p	4932	S000000782	Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Nome	Specification and purity	Expression system	Protein label	Disponibilità	Vedi dettagli

Associated Antibodies

Nome	Specifications	Species reactivity	Applicazione	Disponibilità	Vedi dettagli

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Nome	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.

Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.

RBBP7

Gene and Protein Information

Associated Recombinant Proteins

Associated Antibodies

Related active small molecules

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Bibliography