Toggle Nav 
Cerca
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | E3 ubiquitin-protein ligase RBX1 |
|---|
Gene and Protein Information
| Gene ID | 9978 |
|---|---|
| Uniprot Accession IDs | P62877 B2RDY1 Q8N6Z8 Q9D1S2 Q9WUK9 Q9Y254 |
| Ensembl ID | ENSP00000216225 |
| Symbol | RNF75 ROC1 ROC1 RNF75 BA554C12.1 |
| Family | Belongs to the RING-box family. |
| Sequence | MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 458860 | RBX1 | ring-box 1 | 9598 | VGNC:9926 | OMA, EggNOG |
| Mouse | 56438 | Rbx1 | ring-box 1 | 10090 | MGI:1891829 | Inparanoid, OMA, EggNOG |
| Rat | 300084 | Rbx1 | ring-box 1 | 10116 | RGD:1308453 | Inparanoid, OMA |
| Horse | 100055581 | RBX1 | ring-box 1 | 9796 | VGNC:22259 | Inparanoid, OMA, EggNOG |
| Cow | 518880 | RBX1 | ring-box 1 | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100013521 | RBX1 | ring-box 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | RBX1 | ring-box 1 [Source:HGNC Symbol;Acc:HGNC:9928] | 9258 | OMA, EggNOG | ||
| Chicken | 418001 | RBX1 | ring-box 1 | 9031 | CGNC:9088 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566553 | rbx1 | ring-box 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 449846 | rbx1 | ring-box 1, E3 ubiquitin protein ligase | 7955 | ZDB-GENE-041008-106 | Inparanoid, OMA, EggNOG |
| C. elegans | 179358 | rbx-1 | RING-box protein 1 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 31014 | Roc1a | Regulator of cullins 1a | 7227 | FBgn0025638 | Inparanoid, EggNOG |
| S.cerevisiae | 853986 | HRT1 | SCF ubiquitin ligase complex subunit HRT1 | 4932 | S000005493 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifications | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.