🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PHB

DescrizioneProhibitin

Gene and Protein Information

Gene ID5245
Uniprot Accession IDs P35232 B4DY47 Q4VBQ0
Ensembl ID ENSP00000479488
Symbol PHB1 HEL-215 HEL-S-54e
FamilyBelongs to the prohibitin family.
Sequence
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp455205PHBprohibitin9598VGNC:9514OMA, EggNOG
Macaque699334PHBprohibitin9544OMA, EggNOG
Mouse18673Phbprohibitin10090MGI:97572Inparanoid, OMA, EggNOG
Rat25344Phbprohibitin10116RGD:3322Inparanoid, OMA, EggNOG
Dog480547PHBprohibitin9615Inparanoid, OMA, EggNOG
Horse100056039PHBprohibitin9796VGNC:21368Inparanoid, OMA, EggNOG
Cow530409PHBprohibitin9913VGNC:32808Inparanoid, OMA, EggNOG
Pig100524707PHBprohibitin9823OMA, EggNOG
Opossum100618482PHBprohibitin13616Inparanoid, OMA, EggNOG
Anole lizard100564329phbprohibitin28377OMA, EggNOG
Xenopus394635phbprohibitin8364XB-GENE-977670Inparanoid, OMA, EggNOG
Zebrafish321346phbprohibitin7955ZDB-GENE-030131-6577Inparanoid, OMA
C. elegans171768phb-1Mitochondrial prohibitin complex protein 16239Inparanoid, OMA
Fruitfly49168l(2)37Cclethal (2) 37Cc7227FBgn0002031Inparanoid, EggNOG
S.cerevisiae853033PHB1prohibitin subunit PHB14932S000003364Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.