🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

NDUFA4

DescrizioneCytochrome c oxidase subunit NDUFA4

Gene and Protein Information

Gene ID4697
Uniprot Accession IDs O00483 A4D109 Q6FHN5
Ensembl ID ENSP00000339720
Symbol MLRQ CI-9k COXFA4 CI-MLRQ
FamilyBelongs to the complex IV NDUFA4 subunit family.
Sequence
MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Mouse17992Ndufa4Ndufa4, mitochondrial complex associated10090MGI:107686Inparanoid, OMA, EggNOG
Rat681024Ndufa4NDUFA4, mitochondrial complex associated10116RGD:1584719Inparanoid, OMA, EggNOG
HorseNDUFA4NDUFA4, mitochondrial complex associated [Source:HGNC Symbol;Acc:HGNC:7687]9796OMA, EggNOG
Cow327704NDUFA4NDUFA4, mitochondrial complex associated9913VGNC:31947Inparanoid, OMA, EggNOG
Pig100579141NDUFA4NDUFA4, mitochondrial complex associated9823OMA, EggNOG
Opossum100025610NDUFA4NDUFA4, mitochondrial complex associated13616Inparanoid, OMA, EggNOG
Chicken772135NDUFA4NDUFA4, mitochondrial complex associated9031CGNC:66679Inparanoid, OMA
Zebrafish406298ndufa4NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 47955ZDB-GENE-040426-1962Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.