Toggle Nav 
Cerca
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 54539 |
|---|---|
| Uniprot Accession IDs | Q9NX14 Q5JRR3 Q5JRR4 Q6IAB6 Q8WZ96 Q9BXX9 |
| Ensembl ID | ENSP00000276062 |
| Symbol | ESSS Np15 P17.3 NP17.3 CI-ESSS MC1DN30 |
| Family | Belongs to the complex I NDUFB11 subunit family. |
| Sequence | MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 473588 | NDUFB11 | NADH:ubiquinone oxidoreductase subunit B11 | 9598 | VGNC:14736 | Inparanoid, OMA, EggNOG |
| Mouse | 104130 | Ndufb11 | NADH:ubiquinone oxidoreductase subunit B11 | 10090 | MGI:1349919 | Inparanoid, OMA |
| Rat | 299310 | Ndufb11 | NADH:ubiquinone oxidoreductase subunit B11 | 10116 | RGD:1563698 | Inparanoid, OMA, EggNOG |
| Dog | 480894 | NDUFB11 | NADH:ubiquinone oxidoreductase subunit B11 | 9615 | VGNC:43700 | Inparanoid, OMA, EggNOG |
| Horse | 100060719 | NDUFB11 | NADH:ubiquinone oxidoreductase subunit B11 | 9796 | VGNC:20637 | Inparanoid, OMA, EggNOG |
| Cow | 404161 | NDUFB11 | NADH:ubiquinone oxidoreductase subunit B11 | 9913 | VGNC:31961 | Inparanoid, OMA, EggNOG |
| Opossum | 100618050 | NDUFB11 | NADH:ubiquinone oxidoreductase subunit B11 | 13616 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 562219 | ndufb11 | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11 | 7955 | ZDB-GENE-050309-25 | Inparanoid, EggNOG |
| Fruitfly | 42282 | NP15.6 | CG6008 gene product from transcript CG6008-RA | 7227 | FBgn0027785 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifiche | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Ricordamelo più tardi
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.