🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GAP43

DescrizioneNeuromodulin

Gene and Protein Information

Gene ID2596
Uniprot Accession IDs P17677 A8K0Y4
Ensembl ID ENSP00000377372
Symbol B-50 PP46
FamilyBelongs to the neuromodulin family.
Sequence
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp460599GAP43growth associated protein 439598VGNC:11399Inparanoid, OMA, EggNOG
Macaque711260GAP43growth associated protein 439544Inparanoid, OMA, EggNOG
Mouse14432Gap43growth associated protein 4310090MGI:95639Inparanoid, OMA, EggNOG
Rat29423Gap43growth associated protein 4310116RGD:62071Inparanoid, OMA, EggNOG
Dog478572GAP43growth associated protein 439615VGNC:41108Inparanoid, OMA, EggNOG
Cow281777GAP43growth associated protein 439913VGNC:29247Inparanoid, OMA, EggNOG
Opossum100015043GAP43growth associated protein 4313616Inparanoid, OMA, EggNOG
Chicken427955GAP43growth associated protein 439031CGNC:11226Inparanoid, OMA, EggNOG
Anole lizard100556380gap43growth associated protein 4328377Inparanoid, OMA, EggNOG
Xenopusgap43growth associated protein 43 [Source:Xenbase;Acc:XB-GENE-5899285]8364OMA, EggNOG
Zebrafish30608gap43growth associated protein 437955ZDB-GENE-990415-87Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.