🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

MMP13

DescrizioneCollagenase 3

Gene and Protein Information

Gene ID4322
Uniprot Accession IDs P45452 A8K846 B2RCZ3 Q6NWN6
Ensembl ID ENSP00000260302
Symbol CLG3 MDST MANDP1 MMP-13
FamilyBelongs to the peptidase M10A family.
Sequence
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp451513MMP13matrix metallopeptidase 139598VGNC:1095OMA, EggNOG
Macaque703980MMP13matrix metallopeptidase 139544Inparanoid, OMA, EggNOG
Mouse17386Mmp13matrix metallopeptidase 1310090MGI:1340026Inparanoid, OMA, EggNOG
Rat171052Mmp13matrix metallopeptidase 1310116RGD:620196Inparanoid, OMA, EggNOG
Dog403763MMP13matrix metallopeptidase 139615VGNC:43276Inparanoid, OMA, EggNOG
Horse100009711MMP13matrix metallopeptidase 139796VGNC:49489Inparanoid, OMA, EggNOG
Cow281914MMP13matrix metallopeptidase 139913VGNC:31518Inparanoid, OMA, EggNOG
Pig397346MMP13matrix metallopeptidase 139823OMA, EggNOG
Opossum100012553MMP13matrix metallopeptidase 1313616Inparanoid, OMA, EggNOG
PlatypusMMP13matrix metallopeptidase 13 [Source:HGNC Symbol;Acc:HGNC:7159]9258OMA, EggNOG
Chicken395683MMP13matrix metallopeptidase 139031CGNC:49430Inparanoid, OMA
Anole lizard100552256mmp13matrix metallopeptidase 1328377Inparanoid, OMA
Xenopus100490019mmp13lmatrix metallopeptidase 13 (collagenase 3) like8364XB-GENE-481559Inparanoid, OMA
Zebrafish100006896mmp13bmatrix metallopeptidase 13b7955ZDB-GENE-030131-6152Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.