🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

MIEN1

DescrizioneMigration and invasion enhancer 1

Gene and Protein Information

Gene ID84299
Uniprot Accession IDs Q9BRT3
Ensembl ID ENSP00000377778
Symbol C17orf37 RDX12 XTP4 C35 ORB3 XTP4 RDX12 C17orf37
FamilyBelongs to the SelWTH family.
Sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp746327MIEN1migration and invasion enhancer 19598VGNC:9380OMA, EggNOG
Mouse103742Mien1migration and invasion enhancer 110090MGI:1913678Inparanoid, OMA, EggNOG
Rat102552549LOC102552549migration and invasion enhancer 1-like10116RGD:7553401OMA, EggNOG
Dog480532MIEN1migration and invasion enhancer 19615VGNC:43228OMA, EggNOG
Horse100054686MIEN1migration and invasion enhancer 19796VGNC:20180Inparanoid, OMA, EggNOG
Cow505710MIEN1migration and invasion enhancer 19913VGNC:31468Inparanoid, OMA, EggNOG
Pig100516461MIEN1migration and invasion enhancer 19823OMA, EggNOG
Anole lizard100566110mien1migration and invasion enhancer 128377Inparanoid, OMA, EggNOG
Xenopus548750mien1migration and invasion enhancer 18364XB-GENE-969302OMA, EggNOG
Zebrafish378437selenow2aselenoprotein W, 2a7955ZDB-GENE-030428-1OMA, EggNOG
Fruitfly50123CG15456CG15456 gene product from transcript CG15456-RB7227FBgn0040650Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.