🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

LPAR4

DescrizioneLysophosphatidic acid receptor 4

Gene and Protein Information

Gene ID2846
Uniprot Accession IDs Q99677 B2RAC7 O15132 Q502U9 Q6NSP5 LPA receptor 4
Ensembl ID ENSP00000408205
Symbol GPR23 LPA4 P2RY9 LPA4 P2Y9 GPR23 P2RY9 P2Y5-LIKE
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque707170LPAR4lysophosphatidic acid receptor 49544Inparanoid, OMA
Mouse78134Lpar4lysophosphatidic acid receptor 410090MGI:1925384Inparanoid, OMA
Rat302378Lpar4lysophosphatidic acid receptor 410116RGD:1563686Inparanoid, OMA
Dog491978LPAR4lysophosphatidic acid receptor 49615VGNC:42745Inparanoid, OMA
Horse100071749LPAR4lysophosphatidic acid receptor 49796VGNC:19730Inparanoid, OMA
Cow539738LPAR4lysophosphatidic acid receptor 49913VGNC:30958Inparanoid, OMA
Opossum100020275LPAR4lysophosphatidic acid receptor 413616Inparanoid, OMA
Chicken422149LPAR4lysophosphatidic acid receptor 49031CGNC:3024Inparanoid, OMA
Anole lizard100562456lpar4lysophosphatidic acid receptor 428377Inparanoid, OMA
Xenopus780308lpar4lysophosphatidic acid receptor 48364XB-GENE-989373Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Lysophospholipid (LPA) receptor    /    Lysophosphatidic acid receptor 4

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.