| Descrizione | LIM domain transcription factor LMO4 |
|---|
Gene and Protein Information
| Gene ID | 8543 |
|---|---|
| Uniprot Accession IDs | P61968 D3DT23 O00158 O88894 |
| Ensembl ID | ENSP00000359575 |
| Sequence | MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 737619 | LMO4 | LIM domain only 4 | 9598 | VGNC:11517 | OMA, EggNOG |
| Macaque | 712752 | LMO4 | LIM domain only 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16911 | Lmo4 | LIM domain only 4 | 10090 | MGI:109360 | Inparanoid, OMA, EggNOG |
| Rat | 362051 | Lmo4 | LIM domain only 4 | 10116 | RGD:1305670 | Inparanoid, OMA |
| Dog | 479962 | LMO4 | LIM domain only 4 | 9615 | VGNC:42724 | Inparanoid, OMA, EggNOG |
| Horse | 100052327 | LMO4 | LIM domain only 4 | 9796 | VGNC:19711 | Inparanoid, OMA, EggNOG |
| Cow | 614212 | LMO4 | LIM domain only 4 | 9913 | VGNC:30936 | Inparanoid, OMA, EggNOG |
| Pig | 100127155 | LMO4 | LIM domain only 4 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100010796 | LMO4 | LIM domain only 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100075084 | LMO4 | LIM domain only 4 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 373901 | LMO4 | LIM domain only 4 | 9031 | CGNC:48949 | Inparanoid, OMA, EggNOG |
| Xenopus | 448304 | lmo4.1 | LIM domain only 4, gene 1 | 8364 | XB-GENE-971939 | Inparanoid, OMA, EggNOG |
| Zebrafish | 324849 | lmo4b | LIM domain only 4b | 7955 | ZDB-GENE-030131-3570 | Inparanoid, OMA, EggNOG |
| Fruitfly | 34361 | CG5708 | CG5708 gene product from transcript CG5708-RC | 7227 | FBgn0032196 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifications | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later