🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

DNAJB1

DescrizioneDnaJ homolog subfamily B member 1

Gene and Protein Information

Gene ID3337
Uniprot Accession IDs P25685 B4DX52
Ensembl ID ENSP00000254322
Symbol DNAJ1 HDJ1 HSPF1 Hdj1 Sis1 HSPF1 Hsp40 RSPH16B
Sequence
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp468747DNAJB1DnaJ heat shock protein family (Hsp40) member B19598VGNC:11228OMA, EggNOG
Mouse81489Dnajb1DnaJ heat shock protein family (Hsp40) member B110090MGI:1931874Inparanoid, OMA, EggNOG
Rat361384Dnajb1DnaJ heat shock protein family (Hsp40) member B110116RGD:1304725Inparanoid, OMA
Dog476688DNAJB1DnaJ heat shock protein family (Hsp40) member B19615VGNC:54594Inparanoid, OMA, EggNOG
Horse100065086DNAJB1DnaJ heat shock protein family (Hsp40) member B19796Inparanoid, OMA
Cow538426DNAJB1DnaJ heat shock protein family (Hsp40) member B19913Inparanoid, OMA, EggNOG
Platypus100093557DNAJB1DnaJ heat shock protein family (Hsp40) member B19258Inparanoid, OMA
Anole lizard100567381dnajb1DnaJ heat shock protein family (Hsp40) member B128377Inparanoid, OMA
Xenopus493474dnajb1DnaJ heat shock protein family (Hsp40) member B18364XB-GENE-1003017Inparanoid, OMA
Zebrafish445177dnajb1aDnaJ (Hsp40) homolog, subfamily B, member 1a7955ZDB-GENE-040801-90Inparanoid, OMA
S.cerevisiae855725SIS1type II HSP40 co-chaperone SIS14932S000004952OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.