🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

LIN28A

DescrizioneProtein lin-28 homolog A

Gene and Protein Information

Gene ID79727
Uniprot Accession IDs Q9H9Z2 Lin-28A
Ensembl ID ENSP00000363314
Symbol CSDD1 LIN28 ZCCHC1 CSDD1 LIN28 LIN-28 ZCCHC1 lin-28A
FamilyBelongs to the lin-28 family.
Sequence
MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp456661LIN28Alin-28 homolog A9598VGNC:11510OMA, EggNOG
Mouse83557Lin28alin-28 homolog A (C. elegans)10090MGI:1890546Inparanoid, OMA, EggNOG
Rat500562Lin28alin-28 homolog A10116RGD:1566408Inparanoid, OMA
Dog612162LIN28Alin-28 homolog A9615VGNC:42683Inparanoid, OMA, EggNOG
Horse100071098LIN28Alin-28 homolog A9796VGNC:19673Inparanoid, OMA, EggNOG
Cow614997LIN28Alin-28 homolog A9913Inparanoid, OMA, EggNOG
Pig100142662LIN28Alin-28 homolog A9823OMA, EggNOG
Opossum100012320LIN28Alin-28 homolog A13616Inparanoid, OMA, EggNOG
Anole lizard100554583lin28alin-28 homolog A28377Inparanoid, EggNOG
Xenopus548523lin28alin-28 homolog A8364XB-GENE-491384Inparanoid, OMA, EggNOG
Zebrafish799825si:ch1073-284b18.2si:ch1073-284b18.27955ZDB-GENE-110914-157OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.