🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

MBD2

DescrizioneMethyl-CpG-binding domain protein 2

Gene and Protein Information

Gene ID8932
Uniprot Accession IDs Q9UBB5 O95242 Q9UIS8
Ensembl ID ENSP00000256429
Symbol DMTase NY-CO-41
Sequence
MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque693801MBD2methyl-CpG binding domain protein 29544Inparanoid, OMA
Mouse17191Mbd2methyl-CpG binding domain protein 210090MGI:1333813Inparanoid, OMA, EggNOG
Rat680172Mbd2methyl-CpG binding domain protein 210116RGD:1595452Inparanoid, OMA, EggNOG
Horse100070096MBD2methyl-CpG binding domain protein 29796VGNC:20006Inparanoid, OMA, EggNOG
Pig100511112MBD2methyl-CpG binding domain protein 29823OMA, EggNOG
Opossum100009966MBD2methyl-CpG binding domain protein 213616Inparanoid, OMA, EggNOG
Xenopus100216281mbd2methyl-CpG binding domain protein 28364XB-GENE-493776Inparanoid, EggNOG

Protein Classes

DTO Classes
protein    /    Epigenetic regulator    /    Reader    /    Methyl-CpG-binding domain    /    Methyl-CpG-binding domain protein 2

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.