224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | Nuclear receptor subfamily 1 group I member 2 |
|---|
Gene and Protein Information
| Gene ID | 8856 |
|---|---|
| Uniprot Accession IDs | O75469 Q006P5 Q008C8 Q96AC7 Q9UJ22 Q9UJ23 Q9UJ24 Q9UJ25 Q9UJ26 Q9UJ27 Q9UNW4 |
| Ensembl ID | ENSP00000336528 |
| Symbol | PXR BXR PAR PRR PXR SAR SXR ONR1 PAR1 PAR2 PARq |
| Family | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
| Sequence | MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS Mostra altro |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 745458 | NR1I2 | nuclear receptor subfamily 1 group I member 2 | 9598 | VGNC:7079 | OMA, EggNOG |
| Macaque | 574226 | NR1I2 | nuclear receptor subfamily 1 group I member 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18171 | Nr1i2 | nuclear receptor subfamily 1, group I, member 2 | 10090 | MGI:1337040 | Inparanoid, OMA, EggNOG |
| Rat | 84385 | Nr1i2 | nuclear receptor subfamily 1, group I, member 2 | 10116 | RGD:69057 | Inparanoid, OMA, EggNOG |
| Dog | 403482 | NR1I2 | nuclear receptor subfamily 1 group I member 2 | 9615 | VGNC:53079 | Inparanoid, OMA, EggNOG |
| Horse | NR1I2 | nuclear receptor subfamily 1 group I member 2 [Source:HGNC Symbol;Acc:HGNC:7968] | 9796 | OMA, EggNOG | ||
| Cow | 493713 | NR1I2 | nuclear receptor subfamily 1 group I member 2 | 9913 | VGNC:32233 | Inparanoid, OMA, EggNOG |
| Pig | 397228 | NR1I2 | nuclear receptor subfamily 1 group I member 2 | 9823 | OMA, EggNOG | |
| Opossum | NR1I2 | nuclear receptor subfamily 1 group I member 2 [Source:HGNC Symbol;Acc:HGNC:7968] | 13616 | Inparanoid, OMA, EggNOG | ||
| Xenopus | 100038168 | nr1i2 | nuclear receptor subfamily 1 group I member 2 | 8364 | XB-GENE-480112 | Inparanoid, OMA |
| Zebrafish | 565875 | nr1i2 | nuclear receptor subfamily 1, group I, member 2 | 7955 | ZDB-GENE-030903-3 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifications | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.