🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CA5B

DescrizioneCarbonic anhydrase 5B, mitochondrial

Gene and Protein Information

Gene ID11238
Uniprot Accession IDs Q9Y2D0 A8K4T5
Ensembl ID ENSP00000314099
Symbol CAVB CA-VB
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque713128CA5Bcarbonic anhydrase 5B9544Inparanoid, OMA, EggNOG
Mouse56078Car5bcarbonic anhydrase 5b, mitochondrial10090MGI:1926249Inparanoid, OMA, EggNOG
Rat302669Car5bcarbonic anhydrase 5B10116RGD:1549783Inparanoid, OMA, EggNOG
Dog100856271CA5Bcarbonic anhydrase 5B9615VGNC:38613Inparanoid, OMA, EggNOG
Horse100051095LOC100051095carbonic anhydrase 5B, mitochondrial9796OMA, EggNOG
Cow514494CA5Bcarbonic anhydrase 5B9913VGNC:26655Inparanoid, OMA, EggNOG
Pig100156418CA5Bcarbonic anhydrase 5B9823OMA, EggNOG
Opossum100031763CA5Bcarbonic anhydrase 5B13616Inparanoid, OMA, EggNOG
PlatypusCA5Bcarbonic anhydrase 5B [Source:HGNC Symbol;Acc:HGNC:1378]9258OMA, EggNOG
Xenopus733981ca5bcarbonic anhydrase VB, mitochondrial8364XB-GENE-1003819Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.