C1QA

DescrizioneComplement C1q subcomponent subunit A

Gene and Protein Information

Gene ID712
Uniprot Accession IDs P02745 B2R4X2 Q5T963
Ensembl ID ENSP00000363773
Sequence
MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp749231C1QAcomplement C1q A chain9598VGNC:12979OMA, EggNOG
Mouse12259C1qacomplement component 1, q subcomponent, alpha polypeptide10090MGI:88223Inparanoid, OMA, EggNOG
Rat298566C1qacomplement C1q A chain10116RGD:1306716Inparanoid, OMA, EggNOG
Dog478194C1QAcomplement C1q A chain9615VGNC:38576Inparanoid, OMA, EggNOG
Horse100058097C1QAcomplement C1q A chain9796VGNC:15936Inparanoid, OMA, EggNOG
Cow534961C1QAcomplement C1q A chain9913VGNC:26616Inparanoid, OMA, EggNOG
Pig445461C1QAcomplement C1q A chain9823Inparanoid, OMA, EggNOG
Opossum100025524C1QAcomplement C1q A chain13616Inparanoid, OMA, EggNOG
Chicken419504C1QAcomplement C1q A chain9031CGNC:14626OMA, EggNOG
Anole lizard100556677LOC100556677complement C1q subcomponent subunit A28377OMA, EggNOG
Xenopusc1qacomplement component 1, q subcomponent, A chain [Source:Xenbase;Acc:XB-GENE-6039250]8364OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.