CA3

DescrizioneCarbonic anhydrase 3

Gene and Protein Information

Gene ID761
Uniprot Accession IDs P07451 B2R867 B3KUC8 O60842
Ensembl ID ENSP00000285381
Symbol Car3 CAIII
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque703801CA3carbonic anhydrase 39544Inparanoid, OMA, EggNOG
Mouse12350Car3carbonic anhydrase 310090MGI:88270Inparanoid, OMA, EggNOG
Rat54232Car3carbonic anhydrase 310116RGD:2241Inparanoid, OMA, EggNOG
Dog487032CA3carbonic anhydrase 39615VGNC:38611Inparanoid, OMA, EggNOG
Horse100050125CA3carbonic anhydrase 39796VGNC:15964Inparanoid, OMA, EggNOG
Cow513212CA3carbonic anhydrase 39913VGNC:26653Inparanoid, OMA, EggNOG
Pig494016CA3carbonic anhydrase 39823Inparanoid, OMA, EggNOG
Opossum100018604CA3carbonic anhydrase 313616Inparanoid, OMA, EggNOG
PlatypusCA3carbonic anhydrase 3 [Source:HGNC Symbol;Acc:HGNC:1374]9258OMA, EggNOG
Xenopus100496328ca3carbonic anhydrase III8364XB-GENE-1007186OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.