🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

BTLA

DescrizioneB- and T-lymphocyte attenuator

Gene and Protein Information

Gene ID151888
Uniprot Accession IDs Q7Z6A9 Q3B831 Q3HS85 Q6ZNH9
Ensembl ID ENSP00000333919
Symbol BTLA1 CD272
Sequence
MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp460584BTLAB and T lymphocyte associated9598VGNC:1749OMA, EggNOG
Macaque708202BTLAB and T lymphocyte associated9544Inparanoid, OMA, EggNOG
Mouse208154BtlaB and T lymphocyte associated10090MGI:2658978Inparanoid, OMA, EggNOG
Rat407756BtlaB and T lymphocyte associated10116RGD:1303280Inparanoid, OMA, EggNOG
Dog487975BTLAB and T lymphocyte associated9615VGNC:38561Inparanoid, OMA, EggNOG
Horse100071491BTLAB and T lymphocyte associated9796VGNC:15921Inparanoid, OMA, EggNOG
Cow531767BTLAB and T lymphocyte associated9913VGNC:26602OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.