🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CRYAA

DescrizioneAlpha-crystallin A chain

Gene and Protein Information

Gene ID1404
Uniprot Accession IDs P02489 Q53X53
Ensembl ID ENSP00000482816
Symbol CRYA1 HSPB4 CRT1 CRTL1
FamilyBelongs to the small heat shock protein (HSP20) family.
Sequence
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp458589LOC458589alpha-crystallin A chain9598OMA, EggNOG
Macaque722370CRYAAcrystallin alpha A9544Inparanoid, EggNOG
Mouse12954Cryaacrystallin, alpha A10090MGI:88515Inparanoid, OMA, EggNOG
Rat24273Cryaacrystallin, alpha A10116RGD:2413Inparanoid, OMA, EggNOG
Dog487786CRYAAcrystallin alpha A9615Inparanoid, OMA, EggNOG
Horse100051134CRYAAcrystallin alpha A9796Inparanoid, OMA, EggNOG
Cow281718CRYAAcrystallin alpha A9913Inparanoid, OMA, EggNOG
Opossum100014565CRYAAcrystallin alpha A13616Inparanoid, OMA, EggNOG
Platypus791110CRYAAcrystallin alpha A9258Inparanoid, OMA, EggNOG
Chicken418546CRYAAcrystallin alpha A9031CGNC:12109Inparanoid, OMA, EggNOG
Anole lizard100555261cryaacrystallin alpha A28377Inparanoid, OMA, EggNOG
Xenopus100488185cryaacrystallin alpha A8364XB-GENE-5940571Inparanoid, OMA, EggNOG
Zebrafish100000769cryaacrystallin, alpha A7955ZDB-GENE-020508-1Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.