🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

C1QL3

DescrizioneComplement C1q-like protein 3

Gene and Protein Information

Gene ID389941
Uniprot Accession IDs Q5VWW1 A0PJY4 A0PJY5
Ensembl ID ENSP00000298943
Symbol CTRP13 C1ql K100 CTRP13 C1QTNF13
Sequence
MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp738723C1QL3complement C1q like 39598VGNC:14317OMA, EggNOG
Macaque100429967C1QL3complement C1q like 39544Inparanoid, OMA, EggNOG
Mouse227580C1ql3C1q-like 310090MGI:2387350Inparanoid, OMA, EggNOG
Rat680404C1ql3complement C1q like 310116RGD:1591795Inparanoid, OMA
Cow614045C1QL3complement C1q like 39913VGNC:50059Inparanoid, OMA
Opossum100020521C1QL3complement C1q like 313616Inparanoid, OMA
Anole lizard100554497c1ql3complement C1q like 328377Inparanoid, OMA
Xenopus100493345c1ql3complement component 1, q subcomponent-like 38364XB-GENE-992410Inparanoid, OMA
Zebrafish100151368c1ql3acomplement component 1, q subcomponent-like 3a7955ZDB-GENE-080417-1Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.