🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

APMAP

DescrizioneAdipocyte plasma membrane-associated protein

Gene and Protein Information

Gene ID57136
Uniprot Accession IDs Q9HDC9 A8K514 B4DXG1 Q6UVZ8 Q9GZS8 Q9NUB2
Ensembl ID ENSP00000217456
Symbol C20orf3 BSCv C20orf3
FamilyBelongs to the strictosidine synthase family.
Sequence
MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMMLLESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp458145APMAPadipocyte plasma membrane associated protein9598VGNC:6039OMA, EggNOG
Mouse71881Apmapadipocyte plasma membrane associated protein10090MGI:1919131Inparanoid, OMA, EggNOG
Rat366227Apmapadipocyte plasma membrane associated protein10116RGD:1308874Inparanoid, OMA
Dog608089APMAPadipocyte plasma membrane associated protein9615VGNC:37990Inparanoid, OMA, EggNOG
Horse100057777APMAPadipocyte plasma membrane associated protein9796VGNC:15412Inparanoid, OMA, EggNOG
Cow535740APMAPadipocyte plasma membrane associated protein9913VGNC:26021Inparanoid, OMA, EggNOG
Opossum100033229APMAPadipocyte plasma membrane associated protein13616Inparanoid, EggNOG
Chicken416715APMAPadipocyte plasma membrane associated protein9031CGNC:6565OMA, EggNOG
Anole lizard100561809apmapadipocyte plasma membrane associated protein28377Inparanoid, OMA, EggNOG
XenopusXB-GENE-955295Putative ortholog of adipocyte plasma membrane-associated protein (Protein DD16), 1 of 1 [Source:Xenbase;Acc:XB-GENE-955295]8364OMA, EggNOG
Zebrafish266637apmapadipocyte plasma membrane associated protein7955ZDB-GENE-020919-1Inparanoid, OMA, EggNOG
C. elegans182407C08E8.2hypothetical protein6239Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.