🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

COX11

DescrizioneCytochrome c oxidase assembly protein COX11, mitochondrial

Gene and Protein Information

Gene ID1353
Uniprot Accession IDs Q9Y6N1 D3DTY5 I3L220 Q6FHB7 Q9BRX0 Q9UME8
Ensembl ID ENSP00000299335
Symbol COX11P
FamilyBelongs to the COX11/CtaG family.
Sequence
MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp748332COX11COX11, cytochrome c oxidase copper chaperone9598VGNC:12146OMA, EggNOG
Macaque641445COX11COX11 homolog, cytochrome c oxidase assembly protein9544Inparanoid, OMA, EggNOG
Mouse69802Cox11cytochrome c oxidase assembly protein 1110090MGI:1917052Inparanoid, OMA, EggNOG
Dog609555COX11COX11 cytochrome c oxidase assembly homolog (yeast)9615Inparanoid, OMA, EggNOG
Horse100056543COX11COX11, cytochrome c oxidase copper chaperone9796VGNC:51473Inparanoid, OMA, EggNOG
Cow510509COX11COX11 cytochrome c oxidase assembly homolog (yeast)9913Inparanoid, OMA, EggNOG
Opossum100014890LOC100014890cytochrome c oxidase assembly protein COX11, mitochondrial13616OMA, EggNOG
Chicken770638COX11COX11, cytochrome c oxidase copper chaperone9031CGNC:66650Inparanoid, OMA
Anole lizard100566567LOC100566567cytochrome c oxidase assembly protein COX11, mitochondrial28377OMA, EggNOG
Xenopuscox11COX11 cytochrome c oxidase copper chaperone [Source:Xenbase;Acc:XB-GENE-6048797]8364OMA, EggNOG
Zebrafish100005158cox11cytochrome c oxidase assembly homolog 11 (yeast)7955ZDB-GENE-050506-82Inparanoid, OMA, EggNOG
C. elegans186814cox-11Cytochrome OXidase assembly protein6239Inparanoid, OMA
Fruitfly33776CG31648CG31648 gene product from transcript CG31648-RA7227FBgn0051648Inparanoid, EggNOG
S.cerevisiae855971COX11Cox11p4932S000006053Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.