🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CLPP

DescrizioneATP-dependent Clp protease proteolytic subunit, mitochondrial

Gene and Protein Information

Gene ID8192
Uniprot Accession IDs Q16740 B2R4W5
Ensembl ID ENSP00000245816
Symbol DFNB81 PRLTS3
FamilyBelongs to the peptidase S14 family.
Sequence
MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp455637CLPPcaseinolytic mitochondrial matrix peptidase proteolytic subunit9598VGNC:2385OMA, EggNOG
Macaque699593CLPPcaseinolytic mitochondrial matrix peptidase proteolytic subunit9544OMA, EggNOG
Mouse53895Clppcaseinolytic mitochondrial matrix peptidase proteolytic subunit10090MGI:1858213Inparanoid, OMA, EggNOG
Rat301117Clppcaseinolytic mitochondrial matrix peptidase proteolytic subunit10116RGD:1588583Inparanoid, OMA, EggNOG
Dog611738CLPPcaseinolytic mitochondrial matrix peptidase proteolytic subunit9615VGNC:39356Inparanoid, OMA, EggNOG
Horse100065472CLPPcaseinolytic mitochondrial matrix peptidase proteolytic subunit9796VGNC:16630Inparanoid, OMA, EggNOG
Cow535981CLPPcaseinolytic mitochondrial matrix peptidase proteolytic subunit9913VGNC:27459Inparanoid, OMA, EggNOG
Anole lizard100558657clppcaseinolytic mitochondrial matrix peptidase proteolytic subunit28377Inparanoid, OMA, EggNOG
Xenopus100135748clppcaseinolytic mitochondrial matrix peptidase proteolytic subunit8364XB-GENE-969408Inparanoid, OMA, EggNOG
Zebrafish553713clppcaseinolytic mitochondrial matrix peptidase proteolytic subunit7955ZDB-GENE-030131-7860Inparanoid, OMA, EggNOG
C. elegans174594clpp-1ATP-dependent Clp protease proteolytic subunit 1, mitochondrial6239Inparanoid, OMA, EggNOG
Fruitfly34402CG5045CG5045 gene product from transcript CG5045-RB7227FBgn0032229Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.