Toggle Nav 
Cerca
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | E3 ubiquitin-protein ligase CHIP |
|---|
Gene and Protein Information
| Gene ID | 10273 |
|---|---|
| Uniprot Accession IDs | Q9UNE7 A2IDB9 O60526 Q969U2 Q9HBT1 |
| Ensembl ID | ENSP00000219548 |
| Symbol | CHIP CHIP SCA48 UBOX1 SCAR16 HSPABP2 NY-CO-7 SDCCAG7 |
| Sequence | MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY Mostra altro |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 453803 | STUB1 | STIP1 homology and U-box containing protein 1 | 9598 | VGNC:9146 | OMA, EggNOG |
| Mouse | 56424 | Stub1 | STIP1 homology and U-Box containing protein 1 | 10090 | MGI:1891731 | Inparanoid, OMA, EggNOG |
| Rat | 287155 | Stub1 | STIP1 homology and U-box containing protein 1 | 10116 | RGD:1306167 | Inparanoid, OMA, EggNOG |
| Dog | 479892 | STUB1 | STIP1 homology and U-box containing protein 1 | 9615 | VGNC:54073 | Inparanoid, OMA, EggNOG |
| Horse | 100066999 | STUB1 | STIP1 homology and U-box containing protein 1 | 9796 | VGNC:51250 | Inparanoid, OMA, EggNOG |
| Cow | 504565 | STUB1 | STIP1 homology and U-box containing protein 1 | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100511251 | STUB1 | STIP1 homology and U-box containing protein 1 | 9823 | OMA, EggNOG | |
| Opossum | 100016998 | STUB1 | STIP1 homology and U-box containing protein 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100565148 | stub1 | STIP1 homology and U-box containing protein 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 779800 | stub1 | STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase | 8364 | XB-GENE-966697 | Inparanoid, OMA, EggNOG |
| Zebrafish | 324243 | stub1 | STIP1 homology and U-Box containing protein 1 | 7955 | ZDB-GENE-030131-2963 | Inparanoid, OMA, EggNOG |
| C. elegans | 172303 | chn-1 | C-term of Hsp70-iNteracting protein (CHIP family) | 6239 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifications | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.