🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

BATF3

DescrizioneBasic leucine zipper transcriptional factor ATF-like 3

Gene and Protein Information

Gene ID55509
Uniprot Accession IDs Q9NR55 B-ATF-3
Ensembl ID ENSP00000243440
Symbol SNFT JDP1 SNFT JUNDM1
FamilyBelongs to the bZIP family.
Sequence
MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp457721BATF3basic leucine zipper ATF-like transcription factor 39598VGNC:11734OMA, EggNOG
Macaque710551BATF3basic leucine zipper ATF-like transcription factor 39544OMA, EggNOG
Mouse381319Batf3basic leucine zipper transcription factor, ATF-like 310090MGI:1925491Inparanoid, OMA, EggNOG
Rat60462Batf3basic leucine zipper ATF-like transcription factor 310116RGD:620501Inparanoid, OMA, EggNOG
Dog490283BATF3basic leucine zipper ATF-like transcription factor 39615VGNC:38387Inparanoid, OMA, EggNOG
Horse100053960BATF3basic leucine zipper ATF-like transcription factor 39796VGNC:15772Inparanoid, OMA, EggNOG
Cow535008BATF3basic leucine zipper ATF-like transcription factor 39913VGNC:26427Inparanoid, OMA, EggNOG
Opossum100016641BATF3basic leucine zipper ATF-like transcription factor 313616Inparanoid, OMA, EggNOG
Anole lizardBATF3basic leucine zipper ATF-like transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:28915]28377Inparanoid, EggNOG
Zebrafish751677batf3basic leucine zipper transcription factor, ATF-like 37955ZDB-GENE-041014-356Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.