🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CDK6

DescrizioneCyclin-dependent kinase 6

Gene and Protein Information

Gene ID1021
Uniprot Accession IDs Q00534 A4D1G0
Ensembl ID ENSP00000265734
Symbol CDKN6 MCPH12 PLSTIRE
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp746968CDK6cyclin dependent kinase 69598VGNC:13637OMA, EggNOG
Macaque701822CDK6cyclin dependent kinase 69544Inparanoid, OMA, EggNOG
Mouse12571Cdk6cyclin-dependent kinase 610090MGI:1277162Inparanoid, OMA, EggNOG
Rat114483Cdk6cyclin-dependent kinase 610116RGD:621121Inparanoid, OMA, EggNOG
Dog609920CDK6cyclin dependent kinase 69615VGNC:54756Inparanoid, OMA
Horse100061625CDK6cyclin dependent kinase 69796VGNC:16354Inparanoid, OMA
Cow511754CDK6cyclin dependent kinase 69913VGNC:27133Inparanoid, OMA
Opossum100021675CDK6cyclin dependent kinase 613616Inparanoid, OMA, EggNOG
Chicken420558CDK6cyclin dependent kinase 69031CGNC:51286Inparanoid, OMA, EggNOG
Anole lizard100558412cdk6cyclin dependent kinase 628377Inparanoid, OMA
Xenopuscdk6cyclin-dependent kinase 6 [Source:Xenbase;Acc:XB-GENE-985427]8364OMA, EggNOG
Zebrafish100034507cdk6cyclin-dependent kinase 67955ZDB-GENE-060503-786Inparanoid, OMA
C. elegans181472cdk-4Cyclin-dependent kinase 4 homolog6239OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.