Toggle Nav 
Cerca
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | Cystine/glutamate transporter |
|---|
Gene and Protein Information
| Gene ID | 23657 |
|---|---|
| Uniprot Accession IDs | Q9UPY5 A8K2U4 |
| Ensembl ID | ENSP00000280612 |
| Symbol | xCT CCBR1 |
| Family | Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family. |
| Sequence | MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL Mostra altro |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 471310 | SLC7A11 | solute carrier family 7 member 11 | 9598 | VGNC:50362 | OMA, EggNOG |
| Macaque | 696516 | SLC7A11 | solute carrier family 7 member 11 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 26570 | Slc7a11 | solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 | 10090 | MGI:1347355 | Inparanoid, OMA, EggNOG |
| Rat | 310392 | Slc7a11 | solute carrier family 7 member 11 | 10116 | RGD:1309275 | Inparanoid, OMA, EggNOG |
| Dog | 483821 | SLC7A11 | solute carrier family 7 member 11 | 9615 | VGNC:46472 | Inparanoid, OMA, EggNOG |
| Horse | 100063433 | SLC7A11 | solute carrier family 7 member 11 | 9796 | VGNC:23267 | Inparanoid, OMA, EggNOG |
| Cow | 524078 | SLC7A11 | solute carrier family 7 member 11 | 9913 | VGNC:34926 | Inparanoid, OMA, EggNOG |
| Opossum | 100027770 | SLC7A11 | solute carrier family 7 member 11 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 428731 | SLC7A11 | solute carrier family 7 member 11 | 9031 | CGNC:7416 | Inparanoid, OMA, EggNOG |
| Xenopus | slc7a11 | solute carrier family 7 member 11 [Source:Xenbase;Acc:XB-GENE-960114] | 8364 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC3 and SLC7 families of heteromeric amino acid transporters (HATs) / SLC7 family / Cystine/glutamate transporter
protein / Transporter / SLC superfamily of solute carriers / SLC3 and SLC7 families of heteromeric amino acid transporters (HATs) / SLC7 family / Cystine/glutamate transporter
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifiche | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Ricordamelo più tardi
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.