🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

VEGFA

DescrizioneVascular endothelial growth factor A

Gene and Protein Information

Gene ID7422
Uniprot Accession IDs P15692 B5BU86 H0Y2S8 H0Y407 H0Y414 H0Y462 H0Y8N2 H3BLW7 O60720 O75875 Q074Z4 Q16889 Q5UB46 Q6P0P5 Q96KJ0 Q96L82 Q96NW5 Q9H1W8 Q9H1W9 Q9UH58 Q9UL23 VEGF-A
Ensembl ID ENSP00000478570
Symbol VEGF VPF VEGF MVCD1
FamilyBelongs to the PDGF/VEGF growth factor family.
Sequence
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque574209VEGFAvascular endothelial growth factor A9544Inparanoid, EggNOG
Mouse22339Vegfavascular endothelial growth factor A10090MGI:103178Inparanoid, OMA, EggNOG
Rat83785Vegfavascular endothelial growth factor A10116RGD:619991Inparanoid, OMA, EggNOG
Dog403802VEGFAvascular endothelial growth factor A9615VGNC:48250Inparanoid, OMA, EggNOG
Horse100033839VEGFAvascular endothelial growth factor A9796Inparanoid, EggNOG
Cow281572VEGFAvascular endothelial growth factor A9913Inparanoid, OMA, EggNOG
Pig397157VEGFAvascular endothelial growth factor A9823Inparanoid, EggNOG
Opossum100012132VEGFAvascular endothelial growth factor A13616OMA, EggNOG
Chicken395909VEGFAvascular endothelial growth factor A9031CGNC:7830Inparanoid, EggNOG
Anole lizard100568086vegfavascular endothelial growth factor A28377Inparanoid, EggNOG
Xenopus100038089vegfavascular endothelial growth factor A8364XB-GENE-485744Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Vascular endothelial growth factor A
DTO Classes
protein    /    Signaling    /    Growth factor    /    Vascular endothelial growth factor A

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.