🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

UNC119

DescrizioneProtein unc-119 homolog A

Gene and Protein Information

Gene ID9094
Uniprot Accession IDs Q13432 A8K8G4 F1T095 O95126
Ensembl ID ENSP00000337040
Symbol RG4 HRG4 POC7 IMD13 POC7A
FamilyBelongs to the PDE6D/unc-119 family.
Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp455028UNC119unc-119 lipid binding chaperone9598VGNC:9763OMA, EggNOG
Macaque716064UNC119unc-119 lipid binding chaperone9544OMA, EggNOG
Mouse22248Unc119unc-119 lipid binding chaperone10090MGI:1328357Inparanoid, OMA, EggNOG
Rat29402Unc119unc-119 lipid binding chaperone10116RGD:3942Inparanoid, OMA, EggNOG
Dog491169UNC119unc-119 lipid binding chaperone9615VGNC:48133Inparanoid, OMA, EggNOG
Horse100059151UNC119unc-119 lipid binding chaperone9796VGNC:24789Inparanoid, OMA, EggNOG
Cow538501UNC119unc-119 lipid binding chaperone9913VGNC:36662Inparanoid, OMA, EggNOG
PlatypusUNC119unc-119 lipid binding chaperone [Source:HGNC Symbol;Acc:HGNC:12565]9258OMA, EggNOG
Chicken771690UNC119unc-119 lipid binding chaperone9031CGNC:2670Inparanoid, OMA
Anole lizardUNC119unc-119 lipid binding chaperone [Source:HGNC Symbol;Acc:HGNC:12565]28377Inparanoid, OMA, EggNOG
Xenopus100127819unc119unc-119 lipid binding chaperone8364XB-GENE-954877Inparanoid, OMA, EggNOG
Zebrafish678653unc119bunc-119 homolog b (C. elegans)7955ZDB-GENE-050201-2OMA, EggNOG
C. elegans176519unc-119Protein unc-1196239OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.