🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

VDAC2

DescrizioneVoltage-dependent anion-selective channel protein 2

Gene and Protein Information

Gene ID7417
Uniprot Accession IDs P45880 Q5VWK1 Q5VWK3 Q6IB40 Q7L3J5 Q9BWK8 Q9Y5I6 VDAC-2
Ensembl ID ENSP00000361635
Symbol POR
FamilyBelongs to the eukaryotic mitochondrial porin family.
Sequence
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp471721LOC471721voltage-dependent anion-selective channel protein 29598OMA, EggNOG
Macaque704257VDAC2voltage dependent anion channel 29544Inparanoid, OMA
Mouse22334Vdac2voltage-dependent anion channel 210090MGI:106915Inparanoid, OMA, EggNOG
Rat83531Vdac2voltage-dependent anion channel 210116RGD:621576Inparanoid, OMA, EggNOG
Dog479255VDAC2voltage dependent anion channel 29615VGNC:48247Inparanoid, OMA, EggNOG
Horse100064276VDAC2voltage dependent anion channel 29796VGNC:24896Inparanoid, OMA, EggNOG
Cow282120VDAC2voltage dependent anion channel 29913VGNC:36783Inparanoid, OMA, EggNOG
Pig397659VDAC2voltage dependent anion channel 29823Inparanoid, OMA, EggNOG
Opossum100012461VDAC2voltage dependent anion channel 213616Inparanoid, EggNOG
Platypus100075011VDAC2voltage dependent anion channel 29258Inparanoid, OMA, EggNOG
Chicken395498VDAC2voltage dependent anion channel 29031CGNC:49348Inparanoid, OMA
Anole lizard100565441vdac2voltage dependent anion channel 228377Inparanoid, OMA
Xenopus548947vdac2voltage-dependent anion channel 28364XB-GENE-954839Inparanoid, OMA
Zebrafish322126vdac2voltage-dependent anion channel 27955ZDB-GENE-030131-845Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.