Toggle Nav 
Cerca
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | Elongation of very long chain fatty acids protein 6 |
|---|
Gene and Protein Information
| Gene ID | 79071 |
|---|---|
| Uniprot Accession IDs | Q9H5J4 Q4W5L0 Q8NCD1 |
| Ensembl ID | ENSP00000378105 |
| Symbol | FACE LCE FAE LCE FACE |
| Family | Belongs to the ELO family. ELOVL6 subfamily. |
| Sequence | MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 461436 | ELOVL6 | ELOVL fatty acid elongase 6 | 9598 | VGNC:596 | OMA, EggNOG |
| Mouse | 170439 | Elovl6 | ELOVL family member 6, elongation of long chain fatty acids (yeast) | 10090 | MGI:2156528 | Inparanoid, OMA, EggNOG |
| Rat | 171402 | Elovl6 | ELOVL fatty acid elongase 6 | 10116 | RGD:620585 | Inparanoid, EggNOG |
| Dog | 487900 | ELOVL6 | ELOVL fatty acid elongase 6 | 9615 | VGNC:40324 | Inparanoid, OMA, EggNOG |
| Horse | 100072829 | ELOVL6 | ELOVL fatty acid elongase 6 | 9796 | VGNC:17542 | Inparanoid, OMA, EggNOG |
| Cow | 533333 | ELOVL6 | ELOVL fatty acid elongase 6 | 9913 | VGNC:28452 | OMA, EggNOG |
| Opossum | 100020799 | ELOVL6 | ELOVL fatty acid elongase 6 | 13616 | OMA, EggNOG | |
| Chicken | 428772 | ELOVL6 | ELOVL fatty acid elongase 6 | 9031 | CGNC:53457 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555143 | elovl6 | ELOVL fatty acid elongase 6 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 550011 | elovl6 | ELOVL fatty acid elongase 6 | 8364 | XB-GENE-942876 | Inparanoid, OMA, EggNOG |
| Zebrafish | 317738 | elovl6 | ELOVL fatty acid elongase 6 | 7955 | ZDB-GENE-030114-1 | Inparanoid, OMA, EggNOG |
| Fruitfly | 39860 | Baldspot | CG3971 gene product from transcript CG3971-RA | 7227 | FBgn0260960 | Inparanoid, EggNOG |
| S.cerevisiae | 853243 | ELO1 | fatty acid elongase ELO1 | 4932 | S000003732 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transferase / acyltransferase / Elongation of very long chain fatty acids protein 6
protein / transferase / acyltransferase / Elongation of very long chain fatty acids protein 6
DTO Classes
protein / Enzyme / Transferase / Acyltransferase / Elongation of very long chain fatty acids protein 6
protein / Enzyme / Transferase / Acyltransferase / Elongation of very long chain fatty acids protein 6
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifiche | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Ricordamelo più tardi
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.