224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | 14-3-3 protein beta/alpha |
|---|
Gene and Protein Information
| Gene ID | 7529 |
|---|---|
| Uniprot Accession IDs | P31946 A8K9K2 E1P616 |
| Ensembl ID | ENSP00000361930 |
| Symbol | HS1 GW128 YWHAA KCIP-1 HEL-S-1 |
| Family | Belongs to the 14-3-3 family. |
| Sequence | MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 458272 | YWHAB | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | 9598 | VGNC:10069 | OMA, EggNOG |
| Macaque | 717788 | YWHAB | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 54401 | Ywhab | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide | 10090 | MGI:1891917 | Inparanoid, OMA, EggNOG |
| Rat | 56011 | Ywhab | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta | 10116 | RGD:61998 | Inparanoid, OMA, EggNOG |
| Dog | 477237 | YWHAB | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | 9615 | VGNC:48508 | Inparanoid, OMA, EggNOG |
| Horse | 100056084 | YWHAB | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | 9796 | VGNC:25117 | Inparanoid, OMA, EggNOG |
| Cow | 286863 | YWHAB | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | 9913 | VGNC:37044 | Inparanoid, OMA, EggNOG |
| Pig | 100153160 | YWHAB | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100024059 | YWHAB | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | 13616 | Inparanoid, EggNOG | |
| Chicken | 419190 | YWHAB | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | 9031 | CGNC:50939 | Inparanoid, OMA |
| Anole lizard | 100556120 | ywhab | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | 28377 | Inparanoid, OMA | |
| Xenopus | 496529 | ywhab | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | 8364 | XB-GENE-1006026 | Inparanoid, OMA, EggNOG |
| Zebrafish | 323055 | ywhaba | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide a | 7955 | ZDB-GENE-030131-6583 | OMA, EggNOG |
| Zebrafish | 406419 | ywhabb | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide b | 7955 | ZDB-GENE-040426-2160 | Inparanoid, OMA |
| C. elegans | 178113 | par-5 | 14-3-3-like protein 1 | 6239 | Inparanoid, OMA | |
| Fruitfly | 36059 | 14-3-3zeta | CG17870 gene product from transcript CG17870-RE | 7227 | FBgn0004907 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifications | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.