🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

ABCF2

DescrizioneATP-binding cassette sub-family F member 2

Gene and Protein Information

Gene ID10061
Uniprot Accession IDs Q9UG63 O60864 Q75MJ0 Q75MJ1 Q96TE8
Ensembl ID ENSP00000222388
Symbol ABC28 HUSSY18 HUSSY-18 EST133090
FamilyBelongs to the ABC transporter superfamily. ABCF family. EF3 subfamily.
Sequence
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Mouse27407Abcf2ATP-binding cassette, sub-family F (GCN20), member 210090MGI:1351657Inparanoid, OMA
Horse100063507ABCF2ATP binding cassette subfamily F member 29796VGNC:14928Inparanoid, OMA
Cow513061ABCF2ATP binding cassette subfamily F member 29913VGNC:25481Inparanoid, OMA
Opossum100015529ABCF2ATP binding cassette subfamily F member 213616Inparanoid, OMA
Zebrafish336770abcf2aATP-binding cassette, sub-family F (GCN20), member 2a7955ZDB-GENE-030131-8714Inparanoid, OMA
C. elegans176771abcf-2ABC transporter, class F6239Inparanoid, OMA
S.cerevisiae856758ARB1ATP-binding cassette family ATPase ARB14932S000000838Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    ATP-binding cassette (ABC) transporter    /    ATP-binding cassette sub-family F member 2
protein    /    nucleic acid binding    /    translation elongation factor    /    ATP-binding cassette sub-family F member 2
protein    /    nucleic acid binding    /    hydrolase    /    ATP-binding cassette sub-family F member 2
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    ATP-binding cassette sub-family F member 2

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.