🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

ADRA1B

DescrizioneAlpha-1B adrenergic receptor

Gene and Protein Information

Gene ID147
Uniprot Accession IDs P35368 B0LPE1
Ensembl ID ENSP00000306662
Symbol ADRA1 ALPHA1BAR
FamilyBelongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1B sub-subfamily.
Sequence
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp736934ADRA1Badrenoceptor alpha 1B9598VGNC:11727OMA, EggNOG
Mouse11548Adra1badrenergic receptor, alpha 1b10090MGI:104774Inparanoid, OMA, EggNOG
Rat24173Adra1badrenoceptor alpha 1B10116RGD:2054Inparanoid, OMA
Dog403962ADRA1Badrenoceptor alpha 1B9615VGNC:37673Inparanoid, OMA, EggNOG
Horse100071055ADRA1Badrenoceptor alpha 1B9796VGNC:15132Inparanoid, OMA, EggNOG
Cow407140ADRA1Badrenoceptor alpha 1B9913VGNC:25694Inparanoid, OMA, EggNOG
Pig100519931ADRA1Badrenoceptor alpha 1B9823Inparanoid, OMA, EggNOG
Opossum100025515ADRA1Badrenoceptor alpha 1B13616Inparanoid, EggNOG
Platypus100074819ADRA1Badrenoceptor alpha 1B9258Inparanoid, OMA, EggNOG
Chicken373890ADRA1Badrenoceptor alpha 1B9031CGNC:48942Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Alpha-1B adrenergic receptor
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Adrenoceptor    /    Alpha adrenoceptor    /    Alpha-1B adrenergic receptor

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.