GRP

DescrizioneGastrin-releasing peptide

Gene and Protein Information

Gene ID2922
Uniprot Accession IDs P07492 P07491 P81553 Q14454 Q53YA0 Q9BSY7 GRP
Ensembl ID ENSP00000256857
Symbol BN GRP-10 proGRP preproGRP
FamilyBelongs to the bombesin/neuromedin-B/ranatensin family.
Sequence
MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp736808GRPgastrin releasing peptide9598VGNC:7316OMA, EggNOG
Macaque696983GRPgastrin releasing peptide9544OMA, EggNOG
Mouse225642Grpgastrin releasing peptide10090MGI:95833Inparanoid, OMA, EggNOG
Rat171101Grpgastrin releasing peptide10116RGD:621740Inparanoid, OMA, EggNOG
Dog610154GRPgastrin releasing peptide9615VGNC:53721OMA, EggNOG
Horse100050124GRPgastrin releasing peptide9796VGNC:18608Inparanoid, OMA, EggNOG
Cow615323GRPgastrin releasing peptide9913VGNC:29664Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.