Il negozio non funziona correttamente quando i cookie sono disabilitati.
I JavaScript sembrano essere disabilitati nel tuo browser. Per una migliore esperienza sul nostro sito, assicurati di attivare i javascript nel tuo browser.
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
GRP Descrizione Gastrin-releasing peptide
Gene and Protein Information Gene ID 2922 Uniprot Accession IDs P07492 P07491 P81553 Q14454 Q53YA0 Q9BSY7 GRP Ensembl ID ENSP00000256857 Symbol BN GRP-10 proGRP preproGRP Family Belongs to the bombesin/neuromedin-B/ranatensin family. Sequence MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Homologous gene and protein info.
Species Gene ID Gene Symbol Nome Codice fiscale Other Gene ID Sorgenti Chimp 736808 GRP gastrin releasing peptide 9598 VGNC:7316 OMA, EggNOG Macaque 696983 GRP gastrin releasing peptide 9544 OMA, EggNOG Mouse 225642 Grp gastrin releasing peptide 10090 MGI:95833 Inparanoid, OMA, EggNOG Rat 171101 Grp gastrin releasing peptide 10116 RGD:621740 Inparanoid, OMA, EggNOG Dog 610154 GRP gastrin releasing peptide 9615 VGNC:53721 OMA, EggNOG Horse 100050124 GRP gastrin releasing peptide 9796 VGNC:18608 Inparanoid, OMA, EggNOG Cow 615323 GRP gastrin releasing peptide 9913 VGNC:29664 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Nome Specification and purity Expression system Protein label Disponibilità Vedi dettagli
Associated Antibodies
Nome Specifications Species reactivity Applicazione Disponibilità Vedi dettagli
Associated Approved Drugs Associated Active Ligands Associated Diseases Nome Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Impostazioni Accetto tutto Decline
Shall we send you a message when we have discounts available?
Remind me later Permetti
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.