🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

ETS1

DescrizioneProtein C-ets-1

Gene and Protein Information

Gene ID2113
Uniprot Accession IDs P14921 A9UL17 F5GYX9 Q14278 Q16080 Q6N087 Q96AC5
Ensembl ID ENSP00000376436
Symbol EWSR2 p54 ETS-1 EWSR2 c-ets-1
FamilyBelongs to the ETS family.
Sequence
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp451695ETS1ETS proto-oncogene 1, transcription factor9598VGNC:8163OMA, EggNOG
Macaque714697ETS1ETS proto-oncogene 1, transcription factor9544Inparanoid, OMA, EggNOG
Mouse23871Ets1E26 avian leukemia oncogene 1, 5' domain10090MGI:95455Inparanoid, OMA, EggNOG
Rat24356Ets1ETS proto-oncogene 1, transcription factor10116RGD:2583Inparanoid, OMA
Dog489287ETS1ETS proto-oncogene 1, transcription factor9615VGNC:40494Inparanoid, OMA, EggNOG
Horse100064559ETS1ETS proto-oncogene 1, transcription factor9796VGNC:17700Inparanoid, OMA, EggNOG
Cow540313ETS1ETS proto-oncogene 1, transcription factor9913VGNC:28626Inparanoid, OMA, EggNOG
Pig100302363ETS1ETS proto-oncogene 1, transcription factor9823Inparanoid, OMA, EggNOG
Opossum100016808ETS1ETS proto-oncogene 1, transcription factor13616Inparanoid, OMA, EggNOG
Chicken396235ETS1v-ets avian erythroblastosis virus E26 oncogene homolog 19031CGNC:3319Inparanoid, OMA, EggNOG
Anole lizard100556201ets1ETS proto-oncogene 1, transcription factor28377Inparanoid, OMA, EggNOG
Xenopus100170599ets1v-ets avian erythroblastosis virus E26 oncogene homolog 18364XB-GENE-6465484Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.