🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

YWHAG

Descrizione14-3-3 protein gamma

Gene and Protein Information

Gene ID7532
Uniprot Accession IDs P61981 O70457 P35214 Q6FH52 Q9UDP2 Q9UN99
Ensembl ID ENSP00000306330
Symbol EIEE56 PPP1R170 14-3-3GAMMA
FamilyBelongs to the 14-3-3 family.
Sequence
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp463489YWHAGtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma9598VGNC:8791OMA, EggNOG
Macaque715517YWHAGtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma9544Inparanoid, OMA, EggNOG
Mouse22628Ywhagtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide10090MGI:108109Inparanoid, OMA, EggNOG
Rat56010Ywhagtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma10116RGD:62002Inparanoid, OMA, EggNOG
Dog489818YWHAGtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma9615VGNC:48509Inparanoid, OMA
Horse100059731YWHAGtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma9796VGNC:25119Inparanoid, OMA
Cow286862YWHAGtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma9913VGNC:37046Inparanoid, OMA
Opossum100029105YWHAGtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma13616Inparanoid, OMA
Chicken427820YWHAGtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma9031CGNC:53200Inparanoid, OMA
Anole lizard100566139ywhagtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma28377Inparanoid, OMA
Xenopus779762ywhagtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma8364XB-GENE-951350Inparanoid, OMA
Zebrafish117604ywhag13-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 17955ZDB-GENE-011115-1Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.