🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

YWHAQ

Descrizione14-3-3 protein theta

Gene and Protein Information

Gene ID10971
Uniprot Accession IDs P27348 D6W4Z5 Q567U5 Q5TZU8 Q9UP48
Ensembl ID ENSP00000371267
Symbol 1C5 HS1 14-3-3
FamilyBelongs to the 14-3-3 family.
Sequence
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp470302YWHAQtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta9598VGNC:8259OMA, EggNOG
Macaque694702YWHAQtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta9544Inparanoid, OMA, EggNOG
Mouse22630Ywhaqtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta10090MGI:891963Inparanoid, OMA, EggNOG
Rat25577Ywhaqtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta10116RGD:3979Inparanoid, OMA
Dog479459LOC47945914-3-3 protein theta-like9615OMA, EggNOG
Horse100057123YWHAQtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta9796VGNC:25120Inparanoid, OMA, EggNOG
Cow768311YWHAQtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta9913VGNC:37047Inparanoid, OMA, EggNOG
Pig100048964YWHAQtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta9823Inparanoid, OMA, EggNOG
Chicken421932YWHAQtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta9031CGNC:12303Inparanoid, OMA
Anole lizard100559510ywhaqtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta28377Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.