🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

XPNPEP2

DescrizioneXaa-Pro aminopeptidase 2

Gene and Protein Information

Gene ID7512
Uniprot Accession IDs O43895 A0AV16 O75994
Ensembl ID ENSP00000360147
Symbol APP2 AEACEI
FamilyBelongs to the peptidase M24B family.
Sequence
MARAHWGCCPWLVLLCACAWGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAARAPDTASWASVLVVSTLAILGWSV
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp465852XPNPEP2X-prolyl aminopeptidase 29598VGNC:14724OMA, EggNOG
Macaque701972XPNPEP2X-prolyl aminopeptidase 29544Inparanoid, OMA, EggNOG
Mouse170745Xpnpep2X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound10090MGI:2180001Inparanoid, OMA, EggNOG
Rat117522Xpnpep2X-prolyl aminopeptidase 210116RGD:621277Inparanoid, OMA, EggNOG
Dog492124XPNPEP2X-prolyl aminopeptidase 29615VGNC:48458Inparanoid, OMA, EggNOG
Horse100059029XPNPEP2X-prolyl aminopeptidase 29796VGNC:25073Inparanoid, OMA, EggNOG
Cow504822XPNPEP2X-prolyl aminopeptidase 29913VGNC:36995Inparanoid, OMA, EggNOG
Pig445538XPNPEP2X-prolyl aminopeptidase 29823Inparanoid, OMA, EggNOG
Opossum100021640XPNPEP2X-prolyl aminopeptidase 213616Inparanoid, OMA, EggNOG
Anole lizard100563559xpnpep2X-prolyl aminopeptidase 228377Inparanoid, OMA, EggNOG
Xenopus100145559xpnpep2X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound8364XB-GENE-969249Inparanoid, OMA, EggNOG
Zebrafish394007xpnpep2X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound7955ZDB-GENE-040426-1151Inparanoid, OMA, EggNOG
S.cerevisiae850630FRA1Fra1p4932S000003952Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.