🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

ASRGL1

DescrizioneIsoaspartyl peptidase/L-asparaginase

Gene and Protein Information

Gene ID80150
Uniprot Accession IDs Q7L266 B2R7Q0 Q567Q4 Q6P1P0 Q8NI34 Q9H6F7
Ensembl ID ENSP00000400057
Symbol ALP CRASH ALP ALP1 CRASH
FamilyBelongs to the Ntn-hydrolase family.
Sequence
MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp739620ASRGL1asparaginase like 19598VGNC:11263OMA, EggNOG
Macaque718871ASRGL1asparaginase like 19544Inparanoid, OMA, EggNOG
Mouse66514Asrgl1asparaginase like 110090MGI:1913764Inparanoid, OMA, EggNOG
Rat246307Asrgl1asparaginase like 110116RGD:708526Inparanoid, OMA, EggNOG
Dog483789ASRGL1asparaginase like 19615VGNC:38192Inparanoid, OMA, EggNOG
Horse100146576ASRGL1asparaginase like 19796VGNC:15594Inparanoid, OMA, EggNOG
Cow767970ASRGL1asparaginase like 19913VGNC:26223Inparanoid, OMA, EggNOG
Pig100517023ASRGL1asparaginase like 19823OMA, EggNOG
Opossum100011584ASRGL1asparaginase like 113616Inparanoid, OMA, EggNOG
Chicken421868ASRGL1asparaginase like 19031CGNC:11904Inparanoid, OMA, EggNOG
Anole lizard100568030asrgl1asparaginase like 128377Inparanoid, OMA, EggNOG
Xenopus100145284asrgl1asparaginase like 18364XB-GENE-989502Inparanoid, OMA
Zebrafish541402asrgl1asparaginase like 17955ZDB-GENE-050320-102Inparanoid, OMA
Fruitfly32488CG7860CG7860 gene product from transcript CG7860-RA7227FBgn0030653Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.