🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

AQP9

DescrizioneAquaporin-9

Gene and Protein Information

Gene ID366
Uniprot Accession IDs O43315 Q9NP32 AQP-9
Ensembl ID ENSP00000219919
Symbol SSC1 SSC1 AQP-9 T17287 HsT17287
FamilyBelongs to the MIP/aquaporin (TC 1.A.8) family.
Sequence
MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp467693AQP9aquaporin 99598VGNC:3581OMA, EggNOG
Macaque700743AQP9aquaporin 99544Inparanoid, OMA, EggNOG
Mouse64008Aqp9aquaporin 910090MGI:1891066Inparanoid, OMA, EggNOG
Rat65054Aqp9aquaporin 910116RGD:68433Inparanoid, OMA
Dog487576AQP9aquaporin 99615VGNC:38021Inparanoid, OMA, EggNOG
Horse100054508AQP9aquaporin 99796VGNC:15436Inparanoid, OMA, EggNOG
Cow516762AQP9aquaporin 99913VGNC:26051Inparanoid, OMA, EggNOG
Pig100127153AQP9aquaporin 99823Inparanoid, OMA, EggNOG
Opossum100027501AQP9aquaporin 913616Inparanoid, EggNOG
Chicken415402AQP9aquaporin 99031CGNC:3133Inparanoid, OMA
Xenopus100493943aqp9aquaporin 98364XB-GENE-481514Inparanoid, OMA, EggNOG
Zebrafish570191aqp9baquaporin 9b7955ZDB-GENE-070911-1Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.