🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

ATE1

DescrizioneArginyl-tRNA--protein transferase 1

Gene and Protein Information

Gene ID11101
Uniprot Accession IDs O95260 O95261 Q5SQQ3 Q8WW04 Arginyltransferase 1
Ensembl ID ENSP00000224652
FamilyBelongs to the R-transferase family.
Sequence
MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDLKTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPPSSQFKATLLESYQVYKRYQMVIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKGQYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRN
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp450786ATE1arginyltransferase 19598VGNC:51966OMA, EggNOG
Macaque705248ATE1arginyltransferase 19544Inparanoid, OMA, EggNOG
Mouse11907Ate1arginyltransferase 110090MGI:1333870Inparanoid, OMA, EggNOG
Rat293526Ate1arginyltransferase 110116RGD:1309335Inparanoid, OMA, EggNOG
Dog486919ATE1arginyltransferase 19615VGNC:38206Inparanoid, OMA, EggNOG
Horse100064881ATE1arginyltransferase 19796VGNC:15608Inparanoid, OMA, EggNOG
Cow534601ATE1arginyltransferase 19913VGNC:26238Inparanoid, OMA, EggNOG
Pig100512816ATE1arginyltransferase 19823Inparanoid, OMA, EggNOG
Opossum100025687ATE1arginyltransferase 113616Inparanoid, EggNOG
Chicken423936ATE1arginyltransferase 19031CGNC:7230Inparanoid, OMA, EggNOG
Anole lizard100562215ate1arginyltransferase 128377Inparanoid, OMA, EggNOG
Xenopus100495601ate1arginyltransferase 18364XB-GENE-961934Inparanoid, OMA, EggNOG
C. elegans172800ate-1Arginyl-tRNA--protein transferase 16239OMA, EggNOG
Fruitfly37288Ate1CG9204 gene product from transcript CG9204-RA7227FBgn0025720Inparanoid, EggNOG
S.cerevisiae852867ATE1arginyltransferase4932S000002985Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.